[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67986.1
DDBJ      :             putative terminal protein Tpg homolog
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67986.1 GT:GENE BAC67986.1 GT:PRODUCT putative terminal protein Tpg homolog GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 323014..323400 GB:FROM 323014 GB:TO 323400 GB:DIRECTION + GB:PRODUCT putative terminal protein Tpg homolog GB:PROTEIN_ID BAC67986.1 LENGTH 128 SQ:AASEQ MHALLILHAAGYRWEVVDSLAALRLAVPGRSAAYTARSRVTPLGVRESITARDQSSFFAARSFLSSTTCSSSHHAARLLQAQQDGTDEDDLRQIAAEALGEVYFRDNGRRAQSLEVKLTDLVDLKFEL GT:EXON 1|1-128:0| SEG 55->76|ssffaarsflssttcssshhaa| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25,59-70,73-74| PSIPRED ccEEEEEEEccccHHHHHHHHHHHEEccccccccHHcccccccccHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEcc //