[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67990.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   47->124 PF11822 * DUF3342 0.00016 24.7 77/317  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67990.1 GT:GENE BAC67990.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 325633..326067 GB:FROM 325633 GB:TO 326067 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67990.1 LENGTH 144 SQ:AASEQ MWPRDLEHLRELALEFRIMHLKSELNAALGRFSIGIGGLDDRYPTILSVAFLQLYNHLAEDATIRECANETCRRNFVRQRGRAEYGQNRTSGIKYCTRECARAQAQRELRRRRRQQNSPLQQPRSEKPAPQDSPEAVGQAGGER GT:EXON 1|1-144:0| SEG 98->125|recaraqaqrelrrrrrqqnsplqqprs| HM:PFM:NREP 1 HM:PFM:REP 47->124|PF11822|0.00016|24.7|77/317|DUF3342| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------1------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 102-144| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHccccc //