[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67993.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->48 PF02247 * Como_LCP 0.00096 34.8 23/373  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67993.1 GT:GENE BAC67993.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(327842..327994) GB:FROM 327842 GB:TO 327994 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67993.1 LENGTH 50 SQ:AASEQ MAAASRRSPRRSQAVGPELVAGQVANRFHAAWSVPRASRTAATTDGCALP GT:EXON 1|1-50:0| SEG 2->14|aaasrrsprrsqa| HM:PFM:NREP 1 HM:PFM:REP 26->48|PF02247|0.00096|34.8|23/373|Como_LCP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccc //