[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67996.1
DDBJ      :             putative IS630 family ISRj1-like transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:HMM:PFM   28->122 PF00665 * rve 1.3e-08 17.0 94/120  
:BLT:SWISS 30->119 YIS5_SHISO 3e-07 25.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67996.1 GT:GENE BAC67996.1 GT:PRODUCT putative IS630 family ISRj1-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(336652..337179) GB:FROM 336652 GB:TO 337179 GB:DIRECTION - GB:PRODUCT putative IS630 family ISRj1-like transposase GB:NOTE IS630 family (337854..336641) Inverted repeat sequence (13/13 bp). Target sequence (CTAG). GB:PROTEIN_ID BAC67996.1 LENGTH 175 SQ:AASEQ MIPRTFPPAPAWSPDGHRIKAELDYSRGPEKTWVYGALRVRDGQQITMTASSRNSVFYQQFLQQIEDANPTGELWIVTDNLSSHNSLSTRTWLEDHPRIHHAFIPVGACWLNLQEGWWRIFRKAALAGRSFANPDDIEHATALATSQLNSRANPWIWGRPAPPTRRLRRRYVYTV GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 30->119|YIS5_SHISO|3e-07|25.6|90/100| SEG 159->170|rpapptrrlrrr| HM:PFM:NREP 1 HM:PFM:REP 28->122|PF00665|1.3e-08|17.0|94/120|rve| OP:NHOMO 126 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ----------1--------------5------------91--1D----------------61--2-B31-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------F--D--------------------13----1----------1---------------------------------------------------------------------------1-----------33-1-1-----11--1---------I---1-11-----------------------------------------1-----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccccccccccccEEEEEEccccccEEEEEEEEEEccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccEEccccHHHHHHHHHHHHccc //