[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67999.1
DDBJ      :             putative IS3L family IS469-likee transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:HMM:PFM   14->55 PF06670 * Etmic-2 0.00058 38.1 42/379  
:BLT:SWISS 13->75 HIS6_METS3 4e-04 25.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67999.1 GT:GENE BAC67999.1 GT:PRODUCT putative IS3L family IS469-likee transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(339271..339735) GB:FROM 339271 GB:TO 339735 GB:DIRECTION - GB:PRODUCT putative IS3L family IS469-likee transposase GB:NOTE IS30 family (339207..342900) Inverted repeat sequence (13/17 bp) GB:PROTEIN_ID BAC67999.1 LENGTH 154 SQ:AASEQ MSPHLDAVRVERVWAAGGVVRIAACTRELTVACPDCGRGSARVHSRYSRTLADVAVGGRPVVIGLSVRRLFCDGPGCGRRTFTEQVEGLTVRYQRRSPLLQHLVQMAGVLLAGRGGARLLQILKVPLSRTSVLFHLMRLPLPAAATPRVLVGLR GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 13->75|HIS6_METS3|4e-04|25.4|63/100| SEG 107->120|agvllagrggarll| HM:PFM:NREP 1 HM:PFM:REP 14->55|PF06670|0.00058|38.1|42/379|Etmic-2| OP:NHOMO 49 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------1--11-----------------1-----66---------------------------------------------------------------------------1-5--2------------------1---------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------11------2------------------------------------1---------1--------------131--3---1---11-----1----------2------------------2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccEEEEEEEEcccEEEEEEEEcccccccHHHccccccccccEEEEEEEcccccEEEEEEEcccEEEEcccccccEEEEEEcccccccHHHccHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHcccccccccEEEEccc //