[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68001.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->180 3b6aB PDBj 1e-17 33.3 %
:RPS:PDB   4->188 3b6aA PDBj 1e-12 29.0 %
:RPS:SCOP  4->60 2o7tA1  a.4.1.9 * 3e-13 31.6 %
:RPS:SCOP  72->183 2g7lA2  a.121.1.1 * 1e-07 20.4 %
:HMM:SCOP  1->67 2g7gA1 a.4.1.9 * 3.4e-11 30.8 %
:HMM:SCOP  70->209 2g7gA2 a.121.1.1 * 3e-29 36.2 %
:RPS:PFM   6->49 PF00440 * TetR_N 1e-04 36.4 %
:RPS:PFM   72->169 PF02909 * TetR_C 1e-06 31.6 %
:HMM:PFM   71->204 PF02909 * TetR_C 6.3e-24 25.8 132/139  
:HMM:PFM   6->51 PF00440 * TetR_N 1.5e-13 30.4 46/47  
:BLT:SWISS 1->145 TETR5_ECOLX 4e-08 25.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68001.1 GT:GENE BAC68001.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 343063..343689 GB:FROM 343063 GB:TO 343689 GB:DIRECTION + GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF02909: Tetracyclin repressor, C-terminal all-alpha domain GB:PROTEIN_ID BAC68001.1 LENGTH 208 SQ:AASEQ MPLERIVSTALQIVDDEGADALSMRTLAQRLGSGTATLYRHFDNRAALVAHVVDRMFGAVELNGDELLAMGWQQALRTVAHTMFEALARHRNAARLLVEEIPLGPNAMALREHCVAALLDSGFPPRLAAHAFATLSRYVLGFAIQVNGHGGGGQLADAQVSAVFQSVDPALFPATVTVAGSMPVPIEDEFSFGLELLLSGLAHLRDDA GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 1->145|TETR5_ECOLX|4e-08|25.0|144/211| SEG 86->97|alarhrnaarll| SEG 189->201|efsfglelllsgl| BL:PDB:NREP 1 BL:PDB:REP 4->180|3b6aB|1e-17|33.3|174/209| RP:PDB:NREP 1 RP:PDB:REP 4->188|3b6aA|1e-12|29.0|183/213| RP:PFM:NREP 2 RP:PFM:REP 6->49|PF00440|1e-04|36.4|44/47|TetR_N| RP:PFM:REP 72->169|PF02909|1e-06|31.6|98/140|TetR_C| HM:PFM:NREP 2 HM:PFM:REP 71->204|PF02909|6.3e-24|25.8|132/139|TetR_C| HM:PFM:REP 6->51|PF00440|1.5e-13|30.4|46/47|TetR_N| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| GO:PFM GO:0016481|"GO:negative regulation of transcription"|PF02909|IPR004111| GO:PFM GO:0016566|"GO:specific transcriptional repressor activity"|PF02909|IPR004111| RP:SCP:NREP 2 RP:SCP:REP 4->60|2o7tA1|3e-13|31.6|57/78|a.4.1.9| RP:SCP:REP 72->183|2g7lA2|1e-07|20.4|103/133|a.121.1.1| HM:SCP:REP 1->67|2g7gA1|3.4e-11|30.8|65/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 70->209|2g7gA2|3e-29|36.2|130/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 43 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ----4---------2-1--------1------1-1-2451---3-1-------1---1------1-312---------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------1-1------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 90.4 SQ:SECSTR ccHTHHHHHHHHHHHHHcGGGccHHHHHHHTTccHHHHHHHHccHHHHHHHHHHHHGGGcccccccTTcTTHHHHHHHHHHHHHHHHHHcTTHHHHHHTcccccHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHHHHTcccTTHHHHHHHHHHHHHHTccTTTcHHHHHTHHHHHcccHHH#################### DISOP:02AL 206-208| PSIPRED ccHHHHHHHHHHHHHHcccccccHHHHHHHHccccccEEcccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccc //