[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68003.1
DDBJ      :             putative invasion protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->80 PF09819 * ABC_cobalt 2.9e-05 35.5 62/129  
:HMM:PFM   55->134 PF06549 * DUF1118 0.00027 28.8 80/114  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68003.1 GT:GENE BAC68003.1 GT:PRODUCT putative invasion protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(345361..345771) GB:FROM 345361 GB:TO 345771 GB:DIRECTION - GB:PRODUCT putative invasion protein GB:NOTE PF07681: DoxX GB:PROTEIN_ID BAC68003.1 LENGTH 136 SQ:AASEQ MPDPSHNSLVTPPRRRHPGSTLMILTITLACLIALIFGASGVLNTLALPKARELAAETGFSVAAYRRIGVLQLAGVAGVVLGLAVPPLGGLAGAGLLLLLAGAVVVHLRQGDPVAKLVPAAVCAVLVASYLAALFA GT:EXON 1|1-136:0| TM:NTM 3 TM:REGION 23->45| TM:REGION 79->101| TM:REGION 113->135| SEG 21->36|tlmiltitlacliali| SEG 69->106|gvlqlagvagvvlglavpplgglagaglllllagavvv| SEG 113->128|pvaklvpaavcavlva| HM:PFM:NREP 2 HM:PFM:REP 17->80|PF09819|2.9e-05|35.5|62/129|ABC_cobalt| HM:PFM:REP 55->134|PF06549|0.00027|28.8|80/114|DUF1118| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-10| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHc //