[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68005.1
DDBJ      :             putative FAD-binding monooxygenase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  243/915 : Eukaryota  88/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.47.1
:525 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->36 2ywlA PDBj 8e-04 48.3 %
:BLT:PDB   21->344 3fmwB PDBj 7e-38 39.7 %
:BLT:PDB   469->524 1iezA PDBj 8e-04 38.5 %
:RPS:PDB   7->338 3c96A PDBj 1e-38 20.7 %
:RPS:SCOP  3->347 1fohA5  c.3.1.2 * 2e-26 24.7 %
:HMM:SCOP  5->347 1k0iA1 c.3.1.2 * 1.1e-59 40.2 %
:HMM:SCOP  368->525 1fohA3 c.47.1.10 * 3.3e-06 22.5 %
:RPS:PFM   8->336 PF01494 * FAD_binding_3 9e-39 41.3 %
:HMM:PFM   7->344 PF01494 * FAD_binding_3 3.6e-76 35.1 336/356  
:BLT:SWISS 9->487 PCPB_SPHCR 4e-41 33.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68005.1 GT:GENE BAC68005.1 GT:PRODUCT putative FAD-binding monooxygenase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(346092..347669) GB:FROM 346092 GB:TO 347669 GB:DIRECTION - GB:PRODUCT putative FAD-binding monooxygenase GB:NOTE PF01360: Monooxygenase GB:PROTEIN_ID BAC68005.1 LENGTH 525 SQ:AASEQ MNNPQAIDVLIIGAGPSGSALAIDLVRRGLDVRIVDRSPHAFDGSRAKGIQPRSLEVLEDLGALDDVLAGGDTYPKLGLHAGPIGVPWKMFPHKEATPDVPYPNTWLIPQFRTDRALHARLSELGREVEFGKELTELTQDEDTVVAKVVGADGVEEIVARYAVGADGGSSAVRKQLDIGFVGTTDESDRVLIVDASVSGLARNRWHMWPGLGGKLIGACPIPDSDMFQWMIRLTPDEKPPQEIGAIIDRIHSHTRNRHIQLHEIHWKSVFRPNIRLAEHYGRGRVFLVGDAAHVHTPAGAQGLNTGMQDGYNLGWKLGQVLAGADPALLETYEAERQPIAAGVLGLSTEKWGGIAKLDPSSMKRGKDEQQLSLTYYGGPLAPDGMRTGTLHVGDRAPDAQLLGADGAETRLFNLFQGPHFTAIAYGPGAARDLELLDWPTTGAQLKRLTVGSAAGGGRAFSDPKNTLQSAYGLTGDTLLLIRPDGYLGHIATRDFLTTTQAAVRAMAPQAKTRTMSQPSHTYPLA GT:EXON 1|1-525:0| BL:SWS:NREP 1 BL:SWS:REP 9->487|PCPB_SPHCR|4e-41|33.4|455/538| BL:PDB:NREP 3 BL:PDB:REP 8->36|2ywlA|8e-04|48.3|29/178| BL:PDB:REP 21->344|3fmwB|7e-38|39.7|300/479| BL:PDB:REP 469->524|1iezA|8e-04|38.5|52/217| RP:PDB:NREP 1 RP:PDB:REP 7->338|3c96A|1e-38|20.7|329/381| RP:PFM:NREP 1 RP:PFM:REP 8->336|PF01494|9e-39|41.3|317/338|FAD_binding_3| HM:PFM:NREP 1 HM:PFM:REP 7->344|PF01494|3.6e-76|35.1|336/356|FAD_binding_3| GO:PFM:NREP 2 GO:PFM GO:0004497|"GO:monooxygenase activity"|PF01494|IPR002938| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01494|IPR002938| RP:SCP:NREP 1 RP:SCP:REP 3->347|1fohA5|2e-26|24.7|304/360|c.3.1.2| HM:SCP:REP 5->347|1k0iA1|1.1e-59|40.2|239/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| HM:SCP:REP 368->525|1fohA3|3.3e-06|22.5|151/201|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 989 OP:NHOMOORG 332 OP:PATTERN ------------------------1------------------------------------------- --1191-1222---553----2--66------755533EA-728-11---1-453114--3A1-52B7533-----------1------------------------1----------------------------------------1----------------------------------1-1-------111111-12-11112-1-11-1112----111------1---------------------------------------------------------------------------------------------------------------------------------------------1--1---------187611-11111------------11311513132-3--3211252-11411-242-----1122222222--1-1-1--------------------------------18--211133455342222244352222236482831--11112---213-43--1----------------1111---------------------------48----------------------------------2--1--11--1------1---------------------------111-1---11-11111-11111-111-11-121-112-1----11111--1--1-------1-------------------1---111111-11------------------1-------------112----1-1-1--------------11111-----11----------------------------------------------------------------------- -----1---------54B4H9E8GAJF6544333334323333444635979HA34765777--1----1----1------22212---5a945E3----222421--5-------------------------------------------------1-------------------1-1111111-28111-1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 524 STR:RPRED 99.8 SQ:SECSTR ccccEEcEEEEEcccHHHHHHHHHHHTTccEEEEEEccccccccccEEEEcHHHHHHHHHTTcHHHHHHHcEEEcEEEEEcTTccEEEEEEcGGGGTccccEcEEEEEEHHHHHHHHHHHHHHHHcTTcEcEEEEEEEEETTEEEEEEEETTcEEEEEEcEEEEcccTTcHHHHHHcTTccccEEEEEcccTTccEEEEEEcTTccEEEEEEccHHHHTTTcEEEEEEEEEETTccccHHHHHHHHTTcccTTccHHHHHHTccEEEEEEEEEcccccccccTTEEEcTHHHHcccccTTcTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHTTccccHHHHHHHHHHHHHHHTTcccccccccccTTGGGcTTccTTccccccEEEETTTccEEHHccccHHEGGGGccccccEEEEEEccTTTTTcTTcHHHHHHHHHcTTcHTHHHHccTTccTTccEEEEEEccccGEEEEEccccccHHHHHHHHHcccccccccccccccEEE# DISOP:02AL 1-3, 514-515, 517-525| PSIPRED cccccEEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccEEEEEcHHHHHHHHHcccHHHHHHHcccccEEEEEEcccccEEEEccccccccccccccEEEEEHHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEEccccEEEEEEEEEEcccccHHHHHHccccccccccccEEEEEEEEcccccccccEEEEEcccccEEEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHccccccccccccEEEEcccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHEEccccccccccccccccccccccccEEEcccccEEEEEEEEccccEEEEEEcccccHHHHHHHHcccccEEEEEEEccccccccccccccHHHHHHHcccccEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHcccccccccccccc //