[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68010.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:423 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   102->348 1b7eA PDBj 1e-07 13.0 %
:RPS:SCOP  236->346 1mm8A  c.55.3.4 * 3e-09 14.4 %
:HMM:SCOP  106->304 1musA_ c.55.3.4 * 1.9e-05 20.7 %
:HMM:PFM   101->297 PF01609 * Transposase_11 1.2e-12 14.8 122/207  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68010.1 GT:GENE BAC68010.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 352678..353949 GB:FROM 352678 GB:TO 353949 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01609: Transposase DDE domain GB:PROTEIN_ID BAC68010.1 LENGTH 423 SQ:AASEQ MRCWPARCPASCPVFGVDVSVWVRSDAECSPGRGYYYHPSRHSAGQPIVAGWAYSWLVGLELKTNSWTAPVDARRLVPGENPNTVAARQIRGLLQQSPELCLQAPLFVFDDGYDSVRPALELTAVPAQILVRVRSDRSFYADPPPRRRTAAGRPRRHGAKFACPDPTTWPAPGRRPHVHGRAVRSSDRADVAPPARQDPAARRPRQPRPRPIIPGTLVRLTVDRLPGRNRAPKTLWLWWTEPPGHTPDPDLLWRAYTRRFDVEHTFRFARQTLNWTLPRPRTPEQADRWTWLVIAAYTQLRLARTLVADHRLPWEKPLPPARLTPGRVRRRFRHVQAVVGTPANPPQPCGRSAGRPPARARTPPPRSQNSRKTRDSPPAGIKAKLRHSRRRDARSWLAERNKSRPRGGCRVEAFSLQRSMEPP GT:EXON 1|1-423:0| SEG 141->159|adppprrrtaagrprrhga| SEG 187->211|dradvapparqdpaarrprqprprp| SEG 350->367|grsagrpparartppprs| RP:PDB:NREP 1 RP:PDB:REP 102->348|1b7eA|1e-07|13.0|223/372| HM:PFM:NREP 1 HM:PFM:REP 101->297|PF01609|1.2e-12|14.8|122/207|Transposase_11| RP:SCP:NREP 1 RP:SCP:REP 236->346|1mm8A|3e-09|14.4|104/455|c.55.3.4| HM:SCP:REP 106->304|1musA_|1.9e-05|20.7|184/0|c.55.3.4|1/1|Ribonuclease H-like| OP:NHOMO 21 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------1--31-----------------1----14------------------------------------------------------------------------------63---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 223 STR:RPRED 52.7 SQ:SECSTR #####################################################################################################GGGEEEEEEEcccHHHHHHHHHHHTcEEEEEEccccccTTTcccHHHHHHTccccEEEEEEEccccccccEEEEEEEcEEEEEccTTc########################cEEEEEEEEEccccccccccEEEEEEccccccHHHHHHHHHHHHTcTHHHHHHHHHHHHHTTTcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHTTcccTTTccHHHHHHHHHHTccccc########################################################################### DISOP:02AL 1-2, 142-155, 348-390, 392-407, 420-423| PSIPRED cccccccccccccEEEEccccccccccccccccEEEEccccccccccccccccEEEEEEEccccccEEEEcccEEcccccccHHHHHHHHHHHHHcccccccccEEEEEEccccccHHHHHHHHccEEEEEEEEccEEEEccccccccccccccccccccccccccccccccccEEcccEEEEEEEEEccccccHHHHHHHHccccccccccccEEEEEEEEEEccccccccccEEEEEEccccccccHHHHHHHHHHHccHHHHHHHHHHHHcccccccccHHHHHHHEEEEEHHHHHHHHHHHHHHHcccccHHccccccccHHHHHccHHHHHEEEccccccccccccccccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEHHHccccc //