[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68011.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->61 PF00672 * HAMP 0.00095 40.0 25/70  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68011.1 GT:GENE BAC68011.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 354545..354832 GB:FROM 354545 GB:TO 354832 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68011.1 LENGTH 95 SQ:AASEQ MAGRWQCRSRSQSSPRWQRIIRPVGRARRLSGYSPGMVWSWLSARRTWRSIRQNTSRATQITWMSAATRPLCWTKTGVTARGPLKSLLNRRLVWG GT:EXON 1|1-95:0| SEG 4->22|rwqcrsrsqssprwqriir| HM:PFM:NREP 1 HM:PFM:REP 37->61|PF00672|0.00095|40.0|25/70|HAMP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccEEcccccccccHHHHHHHHHcccc //