[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68016.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
:202 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->53 PF07442 * Ponericin 0.00024 90.0 10/29  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68016.1 GT:GENE BAC68016.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 362562..363170 GB:FROM 362562 GB:TO 363170 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68016.1 LENGTH 202 SQ:AASEQ MTIGRVWFAAGVTQDLEIVAFESAEAFQAWLGQNHAVSPGIWLKLRKKGPGIAALDYTQALDVALCYGWIDGQKAKFDDQWWLQRFTPRKPRSKWSKANRDKVAALIEQGRMHPPGQAEVDRAKADGRWEAAYDGAKTATVPDDLTAALTADPAAAEFFETLDRQNRYAILYRIQDAKKAETRARRIEKYVAMLAKGEKLHP GT:EXON 1|1-202:0| SEG 138->156|tatvpddltaaltadpaaa| HM:PFM:NREP 1 HM:PFM:REP 42->53|PF07442|0.00024|90.0|10/29|Ponericin| OP:NHOMO 96 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- -12-----------1----------------------222---111---1-1211--1--11-----1----------------------12----1--1-1--1111------------------------------------1-1--111--------------111-------------------------------------1--1-------------1--------1-------------------------1---------1-------------------------------------------------------1------------------------------------------------1--1------------------------------------------1--------1-1-11------1-------------------------------------------------------1----------111--------------------1-1--11--1-11--1-1-----------------------------------------------1--121-----------------------------------1------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------12 -------------------1-----1----------------------111-1111111--------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 199-202| PSIPRED cccccEEEEccccccccccccccHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHHHHHccEEccccHHHHHHHHccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccEEEccHHHHHHHHHcHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccc //