[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68017.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->117 1bylA PDBj 6e-10 18.3 %
:RPS:SCOP  1->117 1bylA  d.32.1.2 * 2e-09 18.3 %
:HMM:SCOP  1->123 1f1uA2 d.32.1.3 * 4.7e-15 31.3 %
:RPS:PFM   5->116 PF00903 * Glyoxalase 6e-05 35.3 %
:HMM:PFM   5->117 PF00903 * Glyoxalase 9.8e-07 24.5 106/128  
:BLT:SWISS 5->116 FOSB_GEOTN 6e-06 31.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68017.1 GT:GENE BAC68017.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(364046..364411) GB:FROM 364046 GB:TO 364411 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC68017.1 LENGTH 121 SQ:AASEQ MSITLNHTIVPAVDNEAAARFFASVMGLDYRGADRHFAPVQVNDSLTLDFMSVENPVGHHLAFDVDPSSFDSILDRLRTAGVPYGNDPSEPDNGRIDHPLCPRGLYFTDDAGNLYEVMSPR GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 5->116|FOSB_GEOTN|6e-06|31.1|103/140| RP:PDB:NREP 1 RP:PDB:REP 1->117|1bylA|6e-10|18.3|109/122| RP:PFM:NREP 1 RP:PFM:REP 5->116|PF00903|6e-05|35.3|102/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 5->117|PF00903|9.8e-07|24.5|106/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->117|1bylA|2e-09|18.3|109/122|d.32.1.2| HM:SCP:REP 1->123|1f1uA2|4.7e-15|31.3|115/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 62 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- --------------111-------11-----111111111-211--------1----1-------11211-----------------------------------------------------------------------------11------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------1-------111111-----11--1111--1--111-----1------12---1-----------------1--------------------------------2--------------------------------------------------------------1-----------------------------------------------------------------------------------------------------1111--------------------------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 100.0 SQ:SECSTR ccccccccEEEEccHHHHHHHHHHTTccEEEEEcccEEEEEETEcccTTTGGGcEEEEEEccHHHHHHHHTTcccccccccccEEcccEEETTEEEEcTTccEEEEEEcTTccEEEEEEcc DISOP:02AL 120-122| PSIPRED cEEEEEEEEEEcccHHHHHHHHHHHcccccccccccEEEEEEccEEEEEEcccccccccEEEEEEcHHHHHHHHHHHHHccccEEcccccccccccccccccEEEEEEcccccEEEEEccc //