[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68019.1
DDBJ      :             putative IS5 family IS1373-like transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68019.1 GT:GENE BAC68019.1 GT:PRODUCT putative IS5 family IS1373-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 368148..368522 GB:FROM 368148 GB:TO 368522 GB:DIRECTION + GB:PRODUCT putative IS5 family IS1373-like transposase GB:NOTE IS3 family (366773..368534) Inverted repeat sequence (11/11 bp) GB:PROTEIN_ID BAC68019.1 LENGTH 124 SQ:AASEQ MVTELAAARAAQREADLHQRRGGDRQKTPAVGLYTGRRPGLTLVDRLLATILYQRFKLPQVVIAPLFTVTPVTLNPAISQTRRLLHDIGHAIEPAETPLATLDDLIDLATHLGIPAPEIKTASY GT:EXON 1|1-124:0| SEG 6->15|aaaraaqrea| SEG 97->112|tplatlddlidlathl| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 12-28, 122-124| PSIPRED cccHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHccccHHHccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccccccc //