[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68021.2
DDBJ      :             putative IS4 family ISFsp5-like transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:262 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 21->197 INSG_ECOLI 7e-10 29.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68021.2 GT:GENE BAC68021.2 GT:PRODUCT putative IS4 family ISFsp5-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(369344..370132) GB:FROM 369344 GB:TO 370132 GB:DIRECTION - GB:PRODUCT putative IS4 family ISFsp5-like transposase GB:NOTE IS4 family (370300..368537) Inverted repeat sequence (21/22 bp). Target sequence (TA). GB:PROTEIN_ID BAC68021.2 LENGTH 262 SQ:AASEQ MAEGRFAPGHLGELTQVIPFDLVDAVLDETRCVQRRLRDLPSRVGVYFLLAMCLFPEVGYRLVWHKLTAALTGVGFEVAEPTAKALRDLRRRLGAEPMKRVFETLAGPLAQPVTPGVRFGPFRMASFDGCSSIKLPDTERNVEWFGPGSRGGYPMLELMTLVETGTRALIGAVFGTPSDGETSYARRLLHHLGPGMLAGPVGQGFRRQRLPRRRARHRSQVPGPAARQPTHPGPEPTHRWLLPLGHRHRPGTRRGSADHRDL GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 21->197|INSG_ECOLI|7e-10|29.1|172/442| SEG 206->218|rrqrlprrrarhr| OP:NHOMO 49 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -------A-------------3--------------------5C----------------1---1--3-----------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------4-------5----2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 216-232, 250-262| PSIPRED cccccccccccHHHHHcccHHHHHHHHHHHccHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccEEEEEEccEEEEccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHccccccccccccccccccccc //