[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68023.1
DDBJ      :             putative IS3 IS1372-like family transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->83 2rn7A PDBj 2e-10 38.6 %
:RPS:PFM   49->77 PF07407 * Seadorna_VP6 5e-04 51.7 %
:HMM:PFM   2->67 PF01527 * Transposase_8 2.7e-13 25.0 64/76  
:BLT:SWISS 1->87 YIA4_MYCTU 6e-17 58.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68023.1 GT:GENE BAC68023.1 GT:PRODUCT putative IS3 IS1372-like family transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 372788..373066 GB:FROM 372788 GB:TO 373066 GB:DIRECTION + GB:PRODUCT putative IS3 IS1372-like family transposase GB:NOTE IS3 family (372707..374011) Inverted repeat sequence (10/11 bp). Target sequence (CC); Translation will be controlled by the frameshift with SAV315. GB:PROTEIN_ID BAC68023.1 LENGTH 92 SQ:AASEQ MRERAVRMYRTADPKPQIKKLAVDLGVHPEALRGWIRQAEADAGERDDRLTTDERAELAALRKENAQLKRANEVLRTASAFFAAQLDPTRPR GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 1->87|YIA4_MYCTU|6e-17|58.3|84/108| BL:PDB:NREP 1 BL:PDB:REP 1->83|2rn7A|2e-10|38.6|83/108| RP:PFM:NREP 1 RP:PFM:REP 49->77|PF07407|5e-04|51.7|29/385|Seadorna_VP6| HM:PFM:NREP 1 HM:PFM:REP 2->67|PF01527|2.7e-13|25.0|64/76|Transposase_8| OP:NHOMO 273 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- -------1-------H111-14--49G4HHE-1415-114--1----2---------*---21---21-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------21-1-2-------3-----------1-2-4-1-B-----------1----------------------------------------------2----4-5-----1-3-----------1----1---1----2--------------------C-------------------------------------------------------------11----------------------------------------------------------2-------------------------------------------------------------------------------------------------------------------------------3-------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------ STR:NPRED 83 STR:RPRED 90.2 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHTTccccccccccccccccccccccccccccccccccccccccc######### DISOP:02AL 1-3, 41-46, 89-92| PSIPRED ccHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //