[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68029.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:193 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68029.1 GT:GENE BAC68029.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(378281..378862) GB:FROM 378281 GB:TO 378862 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00378: Enoyl-CoA hydratase/isomerase family GB:PROTEIN_ID BAC68029.1 LENGTH 193 SQ:AASEQ MSDRNTLIRSLHDVGLAAWFGGSLMGAVGLNGAAKDQSETARARARIASSGWAKWTPVNAAAIGAHLFGGGGLLAVNAHRVAAQKGVGASTTAKTLVTAAALAATAYGRVLGKKVELAASSDPQDAKEAARHPIDIDSAQRQLAFAQWAVPALTGCLVVLNALHGEQQRPEEQLPGMWERARSAATPFIPQHS GT:EXON 1|1-193:0| SEG 60->75|aaaigahlfgggglla| SEG 89->106|asttaktlvtaaalaata| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------1----11-111---------1--1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 36-44, 114-136, 164-176, 192-193| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccc //