[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68032.1
DDBJ      :             putative MerR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:110 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->101 3d71A PDBj 4e-09 25.6 %
:RPS:SCOP  16->103 1exiA1  a.6.1.3 * 8e-07 21.6 %
:HMM:SCOP  18->111 1q06A_ a.6.1.3 * 7.2e-09 30.9 %
:HMM:PFM   19->55 PF00376 * MerR 2.4e-08 45.9 37/38  
:BLT:SWISS 13->89 HSPR_STRCO 3e-06 32.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68032.1 GT:GENE BAC68032.1 GT:PRODUCT putative MerR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(381592..381924) GB:FROM 381592 GB:TO 381924 GB:DIRECTION - GB:PRODUCT putative MerR-family transcriptional regulator GB:NOTE PF00376: MerR family regulatory protein GB:PROTEIN_ID BAC68032.1 LENGTH 110 SQ:AASEQ MTADNPHNRLDDDDYPAYTMGRAAELLGTTQGFLRAIGEARLITPLRSPGGHRRYSRYQLRIAARARELVDQGTPIEAACRIVILEDQLEEAQRINSEQRRAAARHTAGV GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 13->89|HSPR_STRCO|3e-06|32.5|77/151| RP:PDB:NREP 1 RP:PDB:REP 18->101|3d71A|4e-09|25.6|82/277| HM:PFM:NREP 1 HM:PFM:REP 19->55|PF00376|2.4e-08|45.9|37/38|MerR| RP:SCP:NREP 1 RP:SCP:REP 16->103|1exiA1|8e-07|21.6|88/118|a.6.1.3| HM:SCP:REP 18->111|1q06A_|7.2e-09|30.9|94/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 18 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----2--------------------------------13-11----------------------112321----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 80.9 SQ:SECSTR #################EEHHHHHHHHTccHHHHHHHHHTTccccEcTTTccEEEcTTGGGHHHHHHHHHHTTccHHHHHH##HTTccHHHHHHHHHHHHHHHHHHHH## DISOP:02AL 1-7, 94-110| PSIPRED cccccccccccccccccHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHccccccccc //