[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68033.1
DDBJ      :             putative ArsR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  109/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1a.4.5
:98 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->74 1smtB PDBj 9e-05 37.5 %
:RPS:PDB   32->97 1bibA PDBj 3e-12 15.2 %
:RPS:SCOP  26->89 2jn6A1  a.4.1.19 * 7e-10 9.4 %
:HMM:SCOP  32->88 1u2wA1 a.4.5.5 * 8.4e-14 42.1 %
:RPS:PFM   32->63 PF01022 * HTH_5 4e-07 59.4 %
:HMM:PFM   30->64 PF01022 * HTH_5 3.2e-14 61.8 34/47  
:HMM:PFM   52->79 PF03962 * Mnd1 7.3e-05 32.1 28/188  
:BLT:SWISS 30->78 ARSR_ECOLI 4e-11 53.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68033.1 GT:GENE BAC68033.1 GT:PRODUCT putative ArsR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(383053..383349) GB:FROM 383053 GB:TO 383349 GB:DIRECTION - GB:PRODUCT putative ArsR-family transcriptional regulator GB:NOTE PF01022: Bacterial regulatory protein, arsR family GB:PROTEIN_ID BAC68033.1 LENGTH 98 SQ:AASEQ MDFRPGPSLPPWWRTRPHCVLVAGARYSREIGEVCVCELPPAFDLSQPTISHHLKLLRQVGLIDCERRGTWVYYWVLPGLLDKLAAFRRVGRHPWWHA GT:EXON 1|1-98:0| BL:SWS:NREP 1 BL:SWS:REP 30->78|ARSR_ECOLI|4e-11|53.1|49/117| BL:PDB:NREP 1 BL:PDB:REP 35->74|1smtB|9e-05|37.5|40/101| RP:PDB:NREP 1 RP:PDB:REP 32->97|1bibA|3e-12|15.2|66/294| RP:PFM:NREP 1 RP:PFM:REP 32->63|PF01022|4e-07|59.4|32/47|HTH_5| HM:PFM:NREP 2 HM:PFM:REP 30->64|PF01022|3.2e-14|61.8|34/47|HTH_5| HM:PFM:REP 52->79|PF03962|7.3e-05|32.1|28/188|Mnd1| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 26->89|2jn6A1|7e-10|9.4|64/89|a.4.1.19| HM:SCP:REP 32->88|1u2wA1|8.4e-14|42.1|57/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 133 OP:NHOMOORG 110 OP:PATTERN ----------------------------------1--------------------------------- ---14---------2--11-11--111-111121212212-11212111---211-----22--1122411-----------------------------------------------------------------11111---11----------------------1------------------1------------1-1--1----1--------21--------------------------------------------------------------------------------------------------------2---------1-------111---------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----1----------------------11--------------111-1---11-11111---111-111111211--------------1--------111-111--2--------------------------1--------------------------11-----1---11---1-------------------------11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 86.7 SQ:SECSTR #############cHHHHHHHHHHHcTTHHcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTcccccEEEc DISOP:02AL 1-4| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHccc //