[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68034.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 137->196 CAPR1_BOVIN 6e-04 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68034.1 GT:GENE BAC68034.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(383431..384198) GB:FROM 383431 GB:TO 384198 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF07201: Hypersensitivity response secretion protein HrpJ GB:PROTEIN_ID BAC68034.1 LENGTH 255 SQ:AASEQ MSMVGGQWPGAVERLAQQLGAAQAADRRVKEAKATAARQSPSSTGLERAEYQRRLRAHVQTPEHKAAAHAISVAVALMKAHDAALLRSAHTLLARRANGQRLPRRLPRPLVLPGGYAPQWWISSIDSTYAGIWRAIPSPGPELRLGSPNDPLVQEVAKQARLLQASRVGYRGRDDLYEAFHPDGTREGGEPVPPIRGLSPETSRRTNLALGRGDGIRIQPSRMEEAGQMHTDYFAVWDRSRAYAAAVLALLRAHA GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 137->196|CAPR1_BOVIN|6e-04|33.3|60/708| SEG 15->25|laqqlgaaqaa| SEG 66->76|aaahaisvava| SEG 101->113|rlprrlprplvlp| SEG 239->254|rsrayaaavlallrah| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 26-49| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccEEccccccHHHHHHHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccEEEEccccEEEcHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcc //