[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68035.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.204.1
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   34->85 2a3qB PDBj 1e-08 33.3 %
:RPS:SCOP  34->85 2a3qA1  a.204.1.2 * 1e-08 34.6 %
:HMM:SCOP  1->85 2a3qA1 a.204.1.2 * 1.2e-14 36.5 %
:HMM:PFM   33->85 PF03819 * MazG 4.4e-09 37.7 53/74  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68035.1 GT:GENE BAC68035.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(385228..385533) GB:FROM 385228 GB:TO 385533 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03819: MazG nucleotide pyrophosphohydrolase domain GB:PROTEIN_ID BAC68035.1 LENGTH 101 SQ:AASEQ MDIADAQKLAWENKINQGFNTTDIPLEFGLLNAEVGEAFTAWRKGLPDHGEELADVFLYLVAIAEMQGVDLGEEVRREIEKNARRVYTPGVGGALVRTGGE GT:EXON 1|1-101:0| RP:PDB:NREP 1 RP:PDB:REP 34->85|2a3qB|1e-08|33.3|51/108| HM:PFM:NREP 1 HM:PFM:REP 33->85|PF03819|4.4e-09|37.7|53/74|MazG| RP:SCP:NREP 1 RP:SCP:REP 34->85|2a3qA1|1e-08|34.6|52/113|a.204.1.2| HM:SCP:REP 1->85|2a3qA1|1.2e-14|36.5|85/0|a.204.1.2|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1-1----11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 84.2 SQ:SECSTR ccHHHHHHHHHHHHHTTTcccccHHHHHHHHHHcccccGGGccHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHH################ DISOP:02AL 42-49, 99-101| PSIPRED ccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccc //