[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68037.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68037.1 GT:GENE BAC68037.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 386768..387076 GB:FROM 386768 GB:TO 387076 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68037.1 LENGTH 102 SQ:AASEQ MGDRDEGADVAEPVAVEFTAPASSSRSTAYSTTAWRTRPTRRVTHTAVPRLYAEMVAKDRRLRLAGYEIYRFGGFELTAPGGEQILAAFFTELLGRHRKPPL GT:EXON 1|1-102:0| SEG 19->38|tapasssrstaysttawrtr| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------------------------1------------12------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 99-102| PSIPRED cccccccccccccEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHEEEccEEEEcccHHHHHHHHHHHHHHHHccccc //