[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68040.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->54 PF01518 * PolyG_pol 0.00016 26.7 30/366  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68040.1 GT:GENE BAC68040.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(387951..388265) GB:FROM 387951 GB:TO 388265 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68040.1 LENGTH 104 SQ:AASEQ MEGRRRVRVADEVGIDADPDAIGARLLILLEEVNATMRQLARYWDKIRESGDPKTSPAIDALMEILFMGRRVRMHVFLVAQSATARALGGQEVREQFTTRILAS GT:EXON 1|1-104:0| HM:PFM:NREP 1 HM:PFM:REP 25->54|PF01518|0.00016|26.7|30/366|PolyG_pol| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccEEHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHEEccHHHHHHcccHHHHHHHHHHHHcc //