[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68041.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   61->125 1e9rB PDBj 5e-06 30.8 %
:RPS:PFM   68->126 PF01580 * FtsK_SpoIIIE 9e-05 34.5 %
:HMM:PFM   82->123 PF01580 * FtsK_SpoIIIE 1.8e-06 35.0 40/205  
:BLT:SWISS 69->126 FTSK_AGRT5 9e-05 42.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68041.1 GT:GENE BAC68041.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(388386..388766) GB:FROM 388386 GB:TO 388766 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68041.1 LENGTH 126 SQ:AASEQ MGCPTARGARAADTHLRFSRDLVADLITQKLALEGVTFSWHPAERKPYVLVKKTRKSPAEAAFKDPKVRDLVAKAAEPAPIIGSGGKPVSVDLDADSPHILVYASTVGGKSVILRCIACQMIHRGS GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 69->126|FTSK_AGRT5|9e-05|42.1|57/891| RP:PDB:NREP 1 RP:PDB:REP 61->125|1e9rB|5e-06|30.8|65/422| RP:PFM:NREP 1 RP:PFM:REP 68->126|PF01580|9e-05|34.5|58/186|FtsK_SpoIIIE| HM:PFM:NREP 1 HM:PFM:REP 82->123|PF01580|1.8e-06|35.0|40/205|FtsK_SpoIIIE| GO:PFM:NREP 7 GO:PFM GO:0000166|"GO:nucleotide binding"|PF01580|IPR002543| GO:PFM GO:0003677|"GO:DNA binding"|PF01580|IPR002543| GO:PFM GO:0005524|"GO:ATP binding"|PF01580|IPR002543| GO:PFM GO:0007049|"GO:cell cycle"|PF01580|IPR002543| GO:PFM GO:0007059|"GO:chromosome segregation"|PF01580|IPR002543| GO:PFM GO:0016021|"GO:integral to membrane"|PF01580|IPR002543| GO:PFM GO:0051301|"GO:cell division"|PF01580|IPR002543| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 51.6 SQ:SECSTR ############################################################ccccEEEEEccEEcHHHHHHHHccccccEEccGGGGGGcEEEEccTTccHHHHHHHHHHHHHHTT# DISOP:02AL 1-7, 58-61, 125-126| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccEEEEEcccccccHHHccccHHHHHHHHccccccEEcccccEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHccc //