Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68042.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:HMM:PFM   15->66 PF00997 * Casein_kappa 0.00032 21.2 52/182  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68042.1 GT:GENE BAC68042.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 388722..388958 GB:FROM 388722 GB:TO 388958 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68042.1 LENGTH 78 SQ:AASEQ MRVGCASASCSGTTHSRINSRRSRDSSPYAMPPTARAEAAPIPPVSSVARVASPVLPKVLEGVREVATSRPRRTPKAR GT:EXON 1|1-78:0| SEG 16->27|srinsrrsrdss| SEG 39->55|aapippvssvarvaspv| HM:PFM:NREP 1 HM:PFM:REP 15->66|PF00997|0.00032|21.2|52/182|Casein_kappa| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 13-32, 69-78| PSIPRED ccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //