[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68046.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   57->228 1b7eA PDBj 9e-06 7.6 %
:RPS:SCOP  114->240 1mm8A  c.55.3.4 * 3e-08 15.0 %
:HMM:SCOP  1->199 1musA_ c.55.3.4 * 1.5e-05 21.2 %
:HMM:PFM   2->190 PF01609 * Transposase_11 3.6e-05 20.5 117/207  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68046.1 GT:GENE BAC68046.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 392309..393166 GB:FROM 392309 GB:TO 393166 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68046.1 LENGTH 285 SQ:AASEQ MIVSDAGYDVTCLAWVLRDLPVEMVGRVRSDHVMRLPKPPRVHGVNGRPPKHGPKFRFTKPETWPEPAITTVTDTTNYGKAETQAWDRVHPRLTHRSSWLDHDGELPLVEGTLMRLKVEHLSKDRDTPPVWLWSSKTGATPDDVDRFWQAFLRRFDLEHTFRFAKQTLGWTTPKLRTPEAADRWTWILIVAHPQLRLARTLAEDLRRPWEKPTTSDRLTPARVRRGFRNIRAHLACPTRVPKPRGAGAGRPPGAKNKHRAPRYDVGKTVKRPETLKAIGKPGRSW GT:EXON 1|1-285:0| SEG 241->255|pkprgagagrppgak| RP:PDB:NREP 1 RP:PDB:REP 57->228|1b7eA|9e-06|7.6|171/372| HM:PFM:NREP 1 HM:PFM:REP 2->190|PF01609|3.6e-05|20.5|117/207|Transposase_11| RP:SCP:NREP 1 RP:SCP:REP 114->240|1mm8A|3e-08|15.0|120/455|c.55.3.4| HM:SCP:REP 1->199|1musA_|1.5e-05|21.2|170/0|c.55.3.4|1/1|Ribonuclease H-like| OP:NHOMO 24 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------1--22-----------------2-----4------------------------------------------------------------------------------63---13------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 60.0 SQ:SECSTR ########################################################ccTTTcccHHHHHHTccccEEEEEEEccccccccEEEEEEEcEEEEEccTTccEEEEEEEEEccccccccccEEEEEEccccccHHHHHHHHHHHHTcTHHHHHHHHHHHHHTTTcccccccHHHHHHHHHHHHHH#HHHHHHHHHHHHHHHHTTcHHHHHHHTTcccTTTc######################################################### DISOP:02AL 37-51, 241-276, 282-285| PSIPRED cEEEEcccccHHHHHHHHHccHHHHEEHHccEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHcccccccccccEEEEEEEEEcccccccccEEEEEEccccccccHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHccHHHHHHEEcccccccccccccccccccccccccccccccccccccHHHHHHHccccccc //