[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68050.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->37 PF09142 * TruB_C 5e-05 55.0 20/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68050.1 GT:GENE BAC68050.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(397379..397615) GB:FROM 397379 GB:TO 397615 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68050.1 LENGTH 78 SQ:AASEQ MSTKRSLLHRDHPWIGRDVEDTATGRRGVLRAIAPDGDRPRPVAWLLPAGGGMEWTTDPGALANPAPLTADMHPKEER GT:EXON 1|1-78:0| HM:PFM:NREP 1 HM:PFM:REP 16->37|PF09142|5e-05|55.0|20/56|TruB_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 70-78| PSIPRED ccccccHHHcccccccccccccccccccEEEEEcccccccccEEEEEEccccccEEcccccccccccccccccccccc //