[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68051.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:135 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->46 PF01008 * IF-2B 0.00073 27.0 37/281  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68051.1 GT:GENE BAC68051.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(397612..398019) GB:FROM 397612 GB:TO 398019 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68051.1 LENGTH 135 SQ:AASEQ MTRTPDTRENITVAASASAAVLYVCAERSKLTPTLAADRAEAEGRDFAEARGLTITEVVTDPYGDPDPCHRDGWLRVRELAESGAVRVVIVRWPACIAPEPSHELRHREIRWLQDHCVQVRYSWEPLATGGGEAK GT:EXON 1|1-135:0| TM:NTM 1 TM:REGION 10->28| SEG 13->21|vaasasaav| HM:PFM:NREP 1 HM:PFM:REP 10->46|PF01008|0.00073|27.0|37/281|IF-2B| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 132-135| PSIPRED ccccccccccEEEEEcccEEEEEEEcccccccccHHccccccccccHHHHcccEEEEEEccccccccccccccHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHHHHHHHHEEEEEccccccccccccc //