[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68053.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:429 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   39->151 PF06054 * CoiA 1e-08 30.9 %
:HMM:PFM   36->158 PF06054 * CoiA 1.5e-15 26.9 119/375  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68053.1 GT:GENE BAC68053.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(399603..400892) GB:FROM 399603 GB:TO 400892 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF06054: Competence protein CoiA-like family GB:PROTEIN_ID BAC68053.1 LENGTH 429 SQ:AASEQ MGYTAVHPVWGRLDASMDDLGCDRAWTDVHRVKGLRLACPECGGRVFARASQHVVRHFYHQVRPPDCELANESPEHHLLKLELVVAARAAGWRAELEVSSEVRNWRADVMVFDEHDRPFMALEAQLSPMTQDEARMRTDRYARDGVAVCWVALQDRPWERVVPSLRVRSPRRRGETWTVWHGMARYDWAPRTLKAKAKWVHITCPLGDAIRWILDGRVHAHTGANGTVWWTAPAYEDLVLARAQMEAEAEAVRRVAAAERRRQEAEQRAAAAEQHRQDAERRALEWQAELLEWQAELQRLAGFFQRTGLDATVWEAFTQMVRSASGKAIMYGDQSPAHGNGLLVYARPRWTGDGFTLAGVVCPDLEALIEWPAELTILVPNQTWLSRIQAAARSPLKVAVLNPVTGRSTFIRVTAPDVVPVRPNGPDRG GT:EXON 1|1-429:0| COIL:NAA 62 COIL:NSEG 1 COIL:REGION 240->301| SEG 160->173|rvvpslrvrsprrr| SEG 241->283|araqmeaeaeavrrvaaaerrrqeaeqraaaaeqhrqdaerra| RP:PFM:NREP 1 RP:PFM:REP 39->151|PF06054|1e-08|30.9|110/257|CoiA| HM:PFM:NREP 1 HM:PFM:REP 36->158|PF06054|1.5e-15|26.9|119/375|CoiA| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 254-281, 424-429| PSIPRED ccccccccccccccccHHHHccccHHHHHHHHHcccccccccccEEEEEcccEEccEEEEcccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEcccccEEEEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEccccHHHcccHHccccccccccEEEHHHHHHHHccccHHEEccEEEEEEEccccHHHHHHHccEEEEEcccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccEEEEcccccccccEEEEEEccccccccEEEEEEEcccHHHHHccccEEEEEEccHHHHHHHHHHHcccEEEEEEcccccccEEEEEEcccEEEEcccccccc //