[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68058.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.169.1
:155 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  90->125 1mi1A1  a.169.1.1 * 3e-04 41.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68058.1 GT:GENE BAC68058.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 408998..409465 GB:FROM 408998 GB:TO 409465 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68058.1 LENGTH 155 SQ:AASEQ MQTFLPFPDFAASAAALDPRRLGKQRVEALQLLRGLMVPGYGWRHHPAVRMWTGYEEALVRYGLEVCCVWTAAGRADTCAGSLMTDFTAHRADVGVRTQERLAADGELPPWLGNPAFHRSHRSALRRKDPGFYAPLFPDVPEDLPYVWPASDRSR GT:EXON 1|1-155:0| RP:SCP:NREP 1 RP:SCP:REP 90->125|1mi1A1|3e-04|41.7|36/305|a.169.1.1| OP:NHOMO 21 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ---------------------1---1-------111---1----1-----1-111-----11---1-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 151-155| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHccHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHccccccccccHHHHHHHHHHHHHcccccHHHHccccccccccccccccccc //