[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68061.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   174->203 PF07597 * DUF1560 7.8e-06 46.7 30/49  
:HMM:PFM   8->106 PF07937 * DUF1686 4.1e-05 15.8 95/185  
:BLT:SWISS 37->85 ZRT1_SCHPO 2e-04 34.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68061.1 GT:GENE BAC68061.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 413661..414347 GB:FROM 413661 GB:TO 414347 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68061.1 LENGTH 228 SQ:AASEQ MPHVARLMSNCASLAAATAVLAVSFQLNLEPAEAQRRVRPRLVLFATSALGMTVLFTYEQMTHRSPQVYALYLLLFISYLGFAIVDFLVQAVSQSRSTRRSSVRIGLRMAAAGCAFTLVYAVYKLTVLISLGLGFHLVSDHSGCSSLVSTPCVFSVTSPALAALLICVGRTLTAVVYPVSQARRRRWEAQSFEALGPLWQDLSAAMPNIDPDFTRPLRTTPTSCSNVG GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 37->85|ZRT1_SCHPO|2e-04|34.7|49/100| TM:NTM 5 TM:REGION 6->27| TM:REGION 41->62| TM:REGION 70->92| TM:REGION 109->131| TM:REGION 152->174| SEG 12->24|aslaaatavlavs| SEG 92->104|vsqsrstrrssvr| HM:PFM:NREP 2 HM:PFM:REP 174->203|PF07597|7.8e-06|46.7|30/49|DUF1560| HM:PFM:REP 8->106|PF07937|4.1e-05|15.8|95/185|DUF1686| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 94-102, 223-228| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHEEcccHHHHHHHcccHHEEEEHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccHHHHHccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc //