[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68065.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:450 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68065.1 GT:GENE BAC68065.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 420855..422207 GB:FROM 420855 GB:TO 422207 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:NOTE PF07730: Histidine kinase GB:PROTEIN_ID BAC68065.1 LENGTH 450 SQ:AASEQ MVNRPGDDRTVLLRLPTPPQRPTWADDPLDELAERLADVCGAAVHPDEIAAVLESDGLTHQQITTRYSRRDLFAIAEELYTRVPRRFPDPGPGPDPWRTSPWQCLLRGMLFGLPGLAYLLGAGLLPGRVTGLAASALVAWAWNQALAHRAYVRLAAGGRRAAARCLLLGAPAGVTAAAAAALAVSGAGAAPAFAAGEALYLAAATVLLVLGREQHLLIALVPTAAGAACIPLWHPGPVPVAVLLLATVAAAALSAVREIVRSLRTTSSAAPGTPRLTASVPYGLFGLAGGALTLMAPAAGRPAAVVLTLSMGVAEWLLYRYRSLTLTALRHSRTPWGFRLRAVGVLALCLTGYLAVLAAPALVTGVPPLPLLALGAALWVALLLQAAGIAWPSAVACLAAAVAEVALSGGANRGPGLLSPATAELAACGCATAVLLAVACTRMGRTTAHR GT:EXON 1|1-450:0| TM:NTM 10 TM:REGION 113->135| TM:REGION 162->184| TM:REGION 190->211| TM:REGION 213->235| TM:REGION 238->260| TM:REGION 288->310| TM:REGION 341->363| TM:REGION 366->388| TM:REGION 390->412| TM:REGION 422->444| SEG 9->23|rtvllrlptppqrpt| SEG 84->96|prrfpdpgpgpdp| SEG 110->127|lfglpglayllgagllpg| SEG 153->210|rlaaggrraaarclllgapagvtaaaaaalavsgagaapafaagealylaaatvllvl| SEG 240->256|vavlllatvaaaalsav| SEG 283->300|glfglaggaltlmapaag| SEG 352->388|gylavlaapalvtgvpplpllalgaalwvalllqaag| SEG 393->411|savaclaaavaevalsgga| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 85-99, 267-270, 446-450| PSIPRED cccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHEEEEccccHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHccccHHHHHHHHHEEEcccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHHHcHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccc //