[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68069.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  12/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
:222 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->181 PF12138 * Spherulin4 2e-18 35.8 %
:HMM:PFM   5->183 PF12138 * Spherulin4 1.5e-43 31.3 179/251  
:BLT:SWISS 5->170 SR4_PHYPO 4e-11 29.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68069.1 GT:GENE BAC68069.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 425013..425681 GB:FROM 425013 GB:TO 425681 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68069.1 LENGTH 222 SQ:AASEQ MTHGRLLVPLYVHPAVDPAAWQALTRVPSRLYGVVLNVADGPGATRDPAFAAAAGALRAAGIRVLGYLDTAYGTRPHQTVLTELRHHVSWYGTDGVFLDQASAEAGLLPYYRVLGDEARDHGVGTVALNPGMHPDSGYASIADLLVTFEGNWQTYLTSAAPFWTAAHPSARFCHLIHGVPDGLCDLAARTARIRRAGVHCAVPGEGANPWAALPPAVRRGTT GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 5->170|SR4_PHYPO|4e-11|29.6|162/332| SEG 43->63|gatrdpafaaaagalraagir| RP:PFM:NREP 1 RP:PFM:REP 5->181|PF12138|2e-18|35.8|176/244|Spherulin4| HM:PFM:NREP 1 HM:PFM:REP 5->183|PF12138|1.5e-43|31.3|179/251|Spherulin4| OP:NHOMO 35 OP:NHOMOORG 25 OP:PATTERN --------------------------------------------------------------1----- ----1--------------------------------------------------------------311------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1----------------111-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------12413211--------------------1----1------------------------------------------------------------------------------------------------------------------------------------2-----1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 220-222| PSIPRED cccccEEEEEEEcccccHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHHHcccEEEEEEEccHHcccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHccEEEEEcccccccHHHHccccEEEEEcccHHHHHccccccccccccHHHHEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccccccHHHccccc //