[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68070.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  83/915 : Eukaryota  56/199 : Viruses  0/175   --->[See Alignment]
a.104.1
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->128 1wiyB PDBj 3e-10 39.0 %
:RPS:PDB   41->134 3bujA PDBj 1e-12 28.6 %
:RPS:SCOP  41->134 1egyA  a.104.1.1 * 4e-13 26.2 %
:HMM:SCOP  38->177 1e9xA_ a.104.1.1 * 1.1e-23 24.3 %
:RPS:PFM   41->150 PF00067 * p450 6e-14 33.3 %
:HMM:PFM   40->157 PF00067 * p450 7.8e-22 24.1 116/458  
:BLT:SWISS 41->156 CP17A_RAT 4e-14 32.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68070.1 GT:GENE BAC68070.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 425823..426356 GB:FROM 425823 GB:TO 426356 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68070.1 LENGTH 177 SQ:AASEQ MCAAWPPAIGNSGSPASWAASTRSSSAPRRPRRRPSPHRFVKEVLRMWSPPLILVRRARASFDLGTTRLEKAQNYLVSPHMIHRDHRYWQQPDTFDPDRFLPGVPHGPTDRSCYVPFGWAPKKCIGNDIGTTQLMGLCYLICTRYRLSVPNSDTLPMACRFAPVPQRFNGRLALAWN GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 41->156|CP17A_RAT|4e-14|32.8|116/507| SEG 14->39|spaswaastrsssaprrprrrpsphr| BL:PDB:NREP 1 BL:PDB:REP 45->128|1wiyB|3e-10|39.0|77/362| RP:PDB:NREP 1 RP:PDB:REP 41->134|3bujA|1e-12|28.6|84/397| RP:PFM:NREP 1 RP:PFM:REP 41->150|PF00067|6e-14|33.3|108/417|p450| HM:PFM:NREP 1 HM:PFM:REP 40->157|PF00067|7.8e-22|24.1|116/458|p450| GO:PFM:NREP 4 GO:PFM GO:0004497|"GO:monooxygenase activity"|PF00067|IPR001128| GO:PFM GO:0005506|"GO:iron ion binding"|PF00067|IPR001128| GO:PFM GO:0009055|"GO:electron carrier activity"|PF00067|IPR001128| GO:PFM GO:0020037|"GO:heme binding"|PF00067|IPR001128| RP:SCP:NREP 1 RP:SCP:REP 41->134|1egyA|4e-13|26.2|84/403|a.104.1.1| HM:SCP:REP 38->177|1e9xA_|1.1e-23|24.3|140/449|a.104.1.1|1/1|Cytochrome P450| OP:NHOMO 286 OP:NHOMOORG 143 OP:PATTERN ------------------------2--1-11------------------------------------- ----3---------1---------42-----111111113--1-----------------11--1113-1---------------------------------1---------------------------------11-----3-1------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------12-11---11111----------1-34343223--1--112-----1--1---1--1----------------11-----------------------------------1111-------------111111--1111-21-----1--------1-1-1----------1------------------------------------------21-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1-1-11------------------------------------------------------------------ ----1--------------------------------------------------------------------------------------------------3------2251-5-121-11111-1-171-51-----11141-11--1----1-----1--2-327K6-256-832732213333C-211------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 74.6 SQ:SECSTR #######################################HHHHHHHHcccccEEEEEEcccEEETTEEEcTTcEEEEEHHHHTTcTTTcccTTcccTTcccHHHHTTccTcccccTTccGGGccTTHHHHHHHHHHHHHHHHHHEEEEEcTTcEEEEEEcccEEEEEcccE###### DISOP:02AL 176-178| PSIPRED cccccHHHHHcccccEEEEccccccccHHHHHHcHHHHHHHHHHHHHcccccccccEEEccEEEccEEEccccEEEEcHHHccccHHHcccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHcEEEEEcccccccccEEEEEEEEccccccccccc //