Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68071.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68071.1 GT:GENE BAC68071.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(426615..427010) GB:FROM 426615 GB:TO 427010 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68071.1 LENGTH 131 SQ:AASEQ MACSGRVRARGRRRGGQKVMRSRSASSTERGCTATVVVTALLIVGVSACGGEATVDCTGGSYTVECHPVAQPADSTPGTTVPAPALTPSGTCPSDWGEFYKAVHNRSLDWACPLPSFLGPPPDTAAPLPSP GT:EXON 1|1-131:0| TM:NTM 1 TM:REGION 31->51| SEG 5->16|grvrargrrrgg| SEG 33->42|tatvvvtall| SEG 120->130|pppdtaaplps| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-30, 125-131| PSIPRED cccccccHHcHHccHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHcccccccccccccc //