[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68088.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->36 PF07213 * DAP10 0.0008 60.0 15/79  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68088.1 GT:GENE BAC68088.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(449403..449558) GB:FROM 449403 GB:TO 449558 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68088.1 LENGTH 51 SQ:AASEQ MAEWALRYEGITLGLLQQLVICGCIELPLLEGLLLACDSPLPRGTGLLVSD GT:EXON 1|1-51:0| SEG 26->35|elplleglll| HM:PFM:NREP 1 HM:PFM:REP 22->36|PF07213|0.0008|60.0|15/79|DAP10| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 50-51| PSIPRED cccccEEEccEEHHHHHHHHHHccHHHHHHHHHHHHccccccccccEEEcc //