[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68091.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->162 PF06841 * Phage_T4_gp19 3e-19 36.8 %
:HMM:PFM   16->162 PF06841 * Phage_T4_gp19 6.4e-45 40.9 132/134  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68091.1 GT:GENE BAC68091.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 454732..455262 GB:FROM 454732 GB:TO 455262 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68091.1 LENGTH 176 SQ:AASEQ MAQFTVNAARLDPYKNFKFRVKWDNRYVAGISKVSALKRTTEVVEHRDGGDHSSARKSPGRTKYEPITLERGVTHDPEFEAWANKVWNYANAQAAPDQRDREVSLAGFRKDLVIEVYNEAGQKVLAYQVFRCWVSEYQALPDLDANANAVAIQQLKLENEGWLREASVTEPGEPSF GT:EXON 1|1-176:0| RP:PFM:NREP 1 RP:PFM:REP 17->162|PF06841|3e-19|36.8|133/135|Phage_T4_gp19| HM:PFM:NREP 1 HM:PFM:REP 16->162|PF06841|6.4e-45|40.9|132/134|Phage_T4_gp19| GO:PFM:NREP 1 GO:PFM GO:0005198|"GO:structural molecule activity"|PF06841|IPR010667| OP:NHOMO 33 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- -1-----------------------------------------------------------------1---------------------------------1---1-1----------------------------1111----------------------------11-------------1-----------------------------------------------1----------------------------------------------------------------------------------------------------------1----------------------------------1--1-----------1-1----------------------------2-------------------1---1------------------------------------------------------------------------------------------------------------------------------1--1------------11--11--1-----1----------------------------------1---------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 46-52, 170-176| PSIPRED ccccccccccccccccEEEEEEEccEEcccEEEEEcccEEEcEEEEEEccccccEEEccccEEcccEEEEEcccccHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEcccccEEEEEEEEEEEEEEEEEcccccccccEEEEEEEEEEEEcEEEEccccccccccc //