[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68092.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:237 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   73->83 PF10571 * UPF0547 0.00083 54.5 11/26  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68092.1 GT:GENE BAC68092.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 455295..456008 GB:FROM 455295 GB:TO 456008 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68092.1 LENGTH 237 SQ:AASEQ MPGMSTVSAAELLDAWEAGWGRDPLRRGLALLGVARGTTPAAAADVPVGRRDRGLFALRAALFGTAVDAVSRCPECETEVEVAFDQEELLGRLGQADPEACDAVTVREGDREIRVRMPTSTDLAAVLDTGDPAPEEALVRRCAPVGEPAPAADVVAEAWVAADPLVDVRLGVGCPGCGLAWEEPFDIVGYLWAELDAWGRRTLLEVHELARAYGWTQAQTLALSPWRRQCYLGLVGT GT:EXON 1|1-237:0| SEG 25->37|lrrglallgvarg| SEG 143->164|apvgepapaadvvaeawvaadp| HM:PFM:NREP 1 HM:PFM:REP 73->83|PF10571|0.00083|54.5|11/26|UPF0547| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -1-----------------------------------------------------------------1--------------------------------------------------------------------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHEEEEEEHHHHHHHccccccccEEEEEEEccccEEEEEEcccHHHHHHHcccccccHHHHHHHcccccccccHHHHHHHHHHHHcHHHHHHHccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHccc //