[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68094.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:396 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 156->269 SON_MOUSE 5e-04 37.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68094.1 GT:GENE BAC68094.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 456898..458088 GB:FROM 456898 GB:TO 458088 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68094.1 LENGTH 396 SQ:AASEQ MSNSLALAAVTATLRARLFSRLGGPQVTVAPPNKAPDAASGDHVNLFLYRADLNPAFRNADPPGWQPGESPKPVLPLVLHYLLAAYSNDEGKAHELLGAAMLALHDAPVLSGDEIRAATATALPGSDLHLQPERVKITQETLSQDDIAKMWTAFGTPFRMSSAYQVTAVLIDSALPGAAPMPVLRRGADGRGPLARPGTGSPALLGIRYAAAGQVGALPGEQVALLVENLPAVALTARLRHLRVTQSVNVPLATPATGASEVALTLPATGLPAGLWAVDLGPAAGGSVRTNELALGVTPAVTALAAAAAGGTPVRTKVTVTAAQPVLPGQQAAVLVGARQLAVGLLTAAAKPVSVTAVLPSGKTRVRLRVDGVDSEIVDRAHGTFRTGPTVEVTIP GT:EXON 1|1-396:0| BL:SWS:NREP 1 BL:SWS:REP 156->269|SON_MOUSE|5e-04|37.7|114/100| SEG 5->18|lalaavtatlrarl| SEG 293->314|lalgvtpavtalaaaaaggtpv| OP:NHOMO 17 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- -1-----------------------------------------------------------------1--------------------------------------------------------------------11-11-----1-2--------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----------1-1----------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------1--------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 64-69| PSIPRED cccHHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHcccEEEEEEEEEccccccccccccccccccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHccccccHHHHcccccccccHHHccccEEEEEEEEccccHHHHHHHHHHccccccccccEEEEEEcccccccccccccEEEEccccccccccccccccccccccccEEEEEcccccccEEEEEccccEEEEEEEcccEEEEEEEcEEEcccccccEEEEEEcccccccccEEEEEEccccccccEEEEEEEEHHHHHHHEEEcccccccEEEEEEEEEccccccccEEEEEEEcccccHHHHEcccccEEEEEEEccccEEEEEEEcccccHHHHHcccEEEcccEEEEEEc //