[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68098.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   45->92 PF01476 * LysM 9.8e-06 32.6 43/44  
:BLT:SWISS 45->79 Y1288_MYCTU 5e-04 45.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68098.1 GT:GENE BAC68098.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 461251..461568 GB:FROM 461251 GB:TO 461568 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01476: LysM domain GB:PROTEIN_ID BAC68098.1 LENGTH 105 SQ:AASEQ MFTPASRYHGVEVARYEPPDGGDPIPYVRRRLLPDPAGLTPAGFHTVSEGDRLDRIAAAAFGDPELFWRIADANPVLDPPELTDRPGRRLLIALSAAAAGSTHGF GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 45->79|Y1288_MYCTU|5e-04|45.7|35/100| SEG 90->99|llialsaaaa| HM:PFM:NREP 1 HM:PFM:REP 45->92|PF01476|9.8e-06|32.6|43/44|LysM| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -1-----------------------------------------------------------------1--------------------------------------------------------------------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 102-105| PSIPRED cccccccEEEEEEEEEEcccccEEcHHHHHHccccccccccccEEEEEcccHHHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHHHHHcccccccc //