[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68100.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.8
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:SCOP  31->107 2p5zX1  b.40.8.1 * 6e-10 24.6 %
:RPS:PFM   133->184 PF06723 * MreB_Mbl 3e-04 32.7 %
:HMM:PFM   47->119 PF04717 * Phage_base_V 9.3e-11 28.6 70/79  
:HMM:PFM   133->187 PF06723 * MreB_Mbl 0.00028 29.1 55/327  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68100.1 GT:GENE BAC68100.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 462705..463295 GB:FROM 462705 GB:TO 463295 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68100.1 LENGTH 196 SQ:AASEQ MTNMDDIGYVESPGFFSPAQREDAEPPGARRFYGKYRGSVVNNVDPLGTGRLLVSVPDVFGLFPTSWAMPCVPLGGLQSGMFVRPPQQAGVWVEFEGGNPDHPIWTGFFWGGRAETPATAGTLVPGSPVFLVETSGKSKIAVSDSPVTPMKGGGVLLQSPSASITVDSAGVTITAANISLNGLVDINNGALVVKTA GT:EXON 1|1-196:0| RP:PFM:NREP 1 RP:PFM:REP 133->184|PF06723|3e-04|32.7|52/326|MreB_Mbl| HM:PFM:NREP 2 HM:PFM:REP 47->119|PF04717|9.3e-11|28.6|70/79|Phage_base_V| HM:PFM:REP 133->187|PF06723|0.00028|29.1|55/327|MreB_Mbl| GO:PFM:NREP 1 GO:PFM GO:0000902|"GO:cell morphogenesis"|PF06723|IPR004753| RP:SCP:NREP 1 RP:SCP:REP 31->107|2p5zX1|6e-10|24.6|65/71|b.40.8.1| OP:NHOMO 20 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- -1-----------------------------------------------------------------1-------------------------------------1------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----------1-1------------------------------------------------1-------------------------------------------------------1----------------------------------------------------------------------------------2-----------1---1----11-1-------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 25.5 SQ:SECSTR ######################################################################################################################################TTccEEEEEEHHHHHHHTTTccccccccEEEEEEccccEEEEEEETTEEE############ DISOP:02AL 1-4, 17-26, 119-139, 153-154, 156-157| PSIPRED ccccccccEEEcccccccccccccccccEEEEEEccccEEEcccccHHHcEEEEEEEEEcccccEEEEEEEEccccccccEEEccccccEEEEEEccccccccEEEEEEEcccccccccccccccccEEEEEEcccEEEEEEEcccccccccccEEEEccccEEEEEccccEEEEccccEEEEEEEcccEEEEEEc //