Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68108.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:HMM:PFM   18->53 PF02882 * THF_DHG_CYH_C 0.00075 22.2 36/161  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68108.1 GT:GENE BAC68108.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(474824..475045) GB:FROM 474824 GB:TO 475045 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68108.1 LENGTH 73 SQ:AASEQ MSETPETPTAVLLITVWFEPASPTLRARVIQAVDVHTPGETMVLVGRDAVLGVVHEWLDACAHDRPNPPSGAT GT:EXON 1|1-73:0| HM:PFM:NREP 1 HM:PFM:REP 18->53|PF02882|0.00075|22.2|36/161|THF_DHG_CYH_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 64-73| PSIPRED cccccccccEEEEEEEEEcccccHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHccccccccccc //