[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68132.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   65->118 PF01609 * Transposase_11 5.9e-06 29.6 54/207  
:BLT:SWISS 24->133 INSG_ECOLI 8e-08 27.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68132.1 GT:GENE BAC68132.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(570215..570763) GB:FROM 570215 GB:TO 570763 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68132.1 LENGTH 182 SQ:AASEQ MPSTGTGVWSRWTARRWMWRTWANEEFFGRQAGGRGESAFAQARVVALAECGTHAVFGAVIGPAVGGRAELSRQLFPQLGEGKLLLADQGFYGFELWQTARATGADLLWRLRSSAAVPGLQVLDDGSYLSSIRAEADRTVLTAGAQSANRSDRLRRLRLPAGAGLVTLHEAERRPLPAFLLI GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 24->133|INSG_ECOLI|8e-08|27.3|110/442| SEG 11->23|rwtarrwmwrtwa| SEG 153->159|rlrrlrl| HM:PFM:NREP 1 HM:PFM:REP 65->118|PF01609|5.9e-06|29.6|54/207|Transposase_11| OP:NHOMO 42 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------A-------------3--------------------5C----------------1---1--1-----------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------5----2------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 29-38| PSIPRED cccccEEEEEHHHccEEEEEcHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEcccccccEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHHHEEEccccccEEEEEccccccccHHHcc //