[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68137.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  86/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.36.1
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->87 3ey9A PDBj 9e-07 33.3 %
:RPS:PDB   1->73 2ef9B PDBj 7e-09 15.1 %
:RPS:SCOP  13->60 2c31A3  c.36.1.9 * 1e-07 22.9 %
:HMM:SCOP  1->85 1zpdA3 c.36.1.9 * 3.6e-10 29.3 %
:RPS:PFM   3->55 PF02775 * TPP_enzyme_C 2e-04 34.0 %
:HMM:PFM   12->55 PF02775 * TPP_enzyme_C 3.5e-07 36.4 44/150  
:HMM:PFM   87->110 PF00257 * Dehydrin 5.3e-05 45.8 24/153  
:BLT:SWISS 3->74 ILVB_METAO 3e-08 42.6 %
:PROS 46->56|PS00284|SERPIN

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68137.1 GT:GENE BAC68137.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(576830..577165) GB:FROM 576830 GB:TO 577165 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68137.1 LENGTH 111 SQ:AASEQ MSGAPQFLPSQSLPEVPYADFARSLGLGGVRVEKPGDVESAWRQALACDRPFVLDFRTDPAVPPIPPHATLEQIEAAATAILEGDSDRAGVVKQGFKAKVQEMLPGGHRNK GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 3->74|ILVB_METAO|3e-08|42.6|61/599| PROS 46->56|PS00284|SERPIN|PDOC00256| BL:PDB:NREP 1 BL:PDB:REP 13->87|3ey9A|9e-07|33.3|75/571| RP:PDB:NREP 1 RP:PDB:REP 1->73|2ef9B|7e-09|15.1|73/262| RP:PFM:NREP 1 RP:PFM:REP 3->55|PF02775|2e-04|34.0|53/139|TPP_enzyme_C| HM:PFM:NREP 2 HM:PFM:REP 12->55|PF02775|3.5e-07|36.4|44/150|TPP_enzyme_C| HM:PFM:REP 87->110|PF00257|5.3e-05|45.8|24/153|Dehydrin| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02775|IPR011766| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02775|IPR011766| RP:SCP:NREP 1 RP:SCP:REP 13->60|2c31A3|1e-07|22.9|48/183|c.36.1.9| HM:SCP:REP 1->85|1zpdA3|3.6e-10|29.3|82/204|c.36.1.9|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 89 OP:NHOMOORG 86 OP:PATTERN -------------------------------------------------------------------- -11-1-------1-111----1---1-------1111-1--11---------1--1----1-1--1111-------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------1--1-1---------1---------------------11111111--------------------------------------------11-11111111----112111111--12-1----11----------1-------------------11-----------------11-------11-121--------------------------------------------------------------1----------1----------------------------------------------------------------------------------------------------------------------------1-1111--1-1-1111---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 78.4 SQ:SECSTR TTTTccccEEcGGGHHHHHHHHHHHcccEEEEEEEccGGGccccTTTcEEGGGHHHHHHHHHHHHHHHGGGccTTTcccEEEcTTcc######################## DISOP:02AL 107-111| PSIPRED cccccccccccccccccHHHHHHHccccEEEEccHHHHHHHHHHHHHccccEEEEEEEccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccc //