[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68144.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68144.1 GT:GENE BAC68144.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 584755..585144 GB:FROM 584755 GB:TO 585144 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68144.1 LENGTH 129 SQ:AASEQ MARFDDWVTDPEVTLDRVRAFVADPGRVGERFLYRYLVTTTSGTTGHRGVFLLDDRAAAVARALSLRAARRTLTASATARLLAHRERSAHIVATSGHLAACTPGAAGCCRRTARCPTWWTNSTGTGPCS GT:EXON 1|1-129:0| SEG 52->83|llddraaavaralslraarrtltasatarlla| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------1--1-------1----------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------1------------------------------------------------------------------------------------------------------------------------1------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 127-129| PSIPRED ccccccccccHHHHHHHHHHHHHcHHHHHHHHHHEEEEEEEccccccccEEEEEccHHHHHHHHHHHHHHHHcccccEEEEEEcccEEEEEEEcccHHHHHHHHHHHHHccccccccEEcccccccccc //