[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68148.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
b.35.1
:366 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->366 3b6zA PDBj 9e-06 15.1 %
:RPS:SCOP  22->119 1vj1A1  b.35.1.2 * 4e-05 10.9 %
:RPS:PFM   51->358 PF11017 * DUF2855 6e-84 52.4 %
:HMM:PFM   50->358 PF11017 * DUF2855 3.1e-119 49.8 309/314  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68148.1 GT:GENE BAC68148.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(590678..591778) GB:FROM 590678 GB:TO 591778 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68148.1 LENGTH 366 SQ:AASEQ MDTTTTTATAAAVGWNLLIARDDLSIAELADAPVPEVRDGEALLRVDQVGLTANNVTYAALGDSFRYWQFFPASREGWGIVPLWGFAEVVDSRVEGIEPGSRYYGYLPSASHLLVRPGRVDERGFRDASPHRQTLPRPYNAYALTTGDLAYEADREDLQILYRPLFWTSFMLADWLVDNAWLGAATAVLSSASSKTAYGAAFLLQGRGCEIVGLTSRRNVAFTESLGCYDRVLAYEDVVQLPNRPTLYADFAGDERLTASLSAHLGDALVHHVVVGITNQEPGPAGTLAETGPGMFFAPDQMRKRTGEWGRAGLDRRFADAWQRFAPVAEGWVDVVHGQGPQALTQVWREVQSGRTAPRTGHVVIF GT:EXON 1|1-366:0| SEG 3->12|tttttataaa| RP:PDB:NREP 1 RP:PDB:REP 18->366|3b6zA|9e-06|15.1|324/352| RP:PFM:NREP 1 RP:PFM:REP 51->358|PF11017|6e-84|52.4|307/315|DUF2855| HM:PFM:NREP 1 HM:PFM:REP 50->358|PF11017|3.1e-119|49.8|309/314|DUF2855| RP:SCP:NREP 1 RP:SCP:REP 22->119|1vj1A1|4e-05|10.9|92/166|b.35.1.2| OP:NHOMO 38 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------111------------------------------1---------------111--------------------------------------------------------2--1--------------------------------1-------------111-------------------------------------------------------------------------------------1----2--------1----------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------- --------------1-11--1111-11---------------------1----------------------------------------1--11-1-------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 350 STR:RPRED 95.6 SQ:SECSTR ###############ccEEEcTTccEEEEEEEccccccTTcEEEEEEEEEccHHHHTccHTccGGGccTTcccccEEEEEEEcEEEEEEEcTTcccccTTcEEEEEccTTcTTcTTccccccccTTcEEEccTTccHHHHHTcHHHHHHHHHHHHTccccccccccccccccccEEETTTEEcTTcHHHHEcccHHHHHHHHHHHHTTcEEEEEEcGGGHHHHHHTTccEEEETTcTTHHTTTcccEEEEccccHHHHHHHHHHccTTcEEEEEccccccccEEEEEccGGGGGTcccccTTTTcEccccHHHHHHHHHHHHHHHHHHHTTcccEEEEEcHHHHHHHHHHHHTTcc#TTcccEEEE DISOP:02AL 1-3| PSIPRED ccccccHHHHHHHHEEEEEEEccHHHHHHHHcccccccccEEEEEEEEEEEccccHHHHHHHHHHHHHHHccccHHHccEEEcccEEEEEEccccccccccEEEEEcccccEEEEEcccccccccccccHHHccccHHHHHHHHHHHccccHHcHHHHHHHcccEEEEHHHHHHHcccccccccEEEEEEEcccHHHHHHHHHHHHccEEEEEEEcccccEEEEcccccHHHccHHHHHccccccEEEEEccccHHHHHHHHHHHcccEEEEEEEEEEccccccccccccccccEEEcHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcccccccccEEEEc //