[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68149.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:233 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->219 PF09995 * DUF2236 1e-15 34.4 %
:HMM:PFM   25->220 PF09995 * DUF2236 1.2e-38 30.2 189/250  
:BLT:SWISS 25->192 Y2261_MYCBO 2e-06 30.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68149.1 GT:GENE BAC68149.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(592072..592773) GB:FROM 592072 GB:TO 592773 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68149.1 LENGTH 233 SQ:AASEQ MADRVGGVAAAGSADCRSGGRRRHDNFSTYRAHPWRRSEHTMDSGKRLFFSDREGLRREVARLERTHRRLAGTDEQGRPFTALDPAVRVWVLVTLYECMTAMRELSGRPLAPPELDQIYGEFRAVCTEFGLSDDLFPVTAADVPAYMDRTIRERLEYSEPVRYLLFDMLREAPAPRRLGHLKPAWPLVRTVAAHVIGALTIADLPEAFRERFSPPRTRRAALLSLILHRGIAC GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 25->192|Y2261_MYCBO|2e-06|30.0|150/255| RP:PFM:NREP 1 RP:PFM:REP 28->219|PF09995|1e-15|34.4|183/242|DUF2236| HM:PFM:NREP 1 HM:PFM:REP 25->220|PF09995|1.2e-38|30.2|189/250|DUF2236| OP:NHOMO 10 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------1111-----------------------------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------2-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 71-75| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHcc //