[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68152.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->101 2pd1C PDBj 4e-21 45.8 %
:RPS:PDB   6->97 3e8oA PDBj 3e-10 14.3 %
:RPS:SCOP  5->101 2pd1A1  d.58.4.11 * 2e-36 52.6 %
:HMM:SCOP  1->98 1y0hA_ d.58.4.11 * 1.3e-10 29.9 %
:HMM:PFM   10->42 PF03992 * ABM 0.00013 30.3 33/78  
:BLT:SWISS 2->91 Y1783_SYNY3 4e-04 22.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68152.1 GT:GENE BAC68152.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 596538..596843 GB:FROM 596538 GB:TO 596843 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF03992: Antibiotic biosynthesis monooxygenase GB:PROTEIN_ID BAC68152.1 LENGTH 101 SQ:AASEQ MADVKVGLYVSLQAKPGKEEDVADFLRKGLDLVQEEPGTVAWFAVRLNATAFAIFDAFPDVSGRQAHLAGRLAAALMERAPDLLAQPPSIEQLDILAHKLP GT:EXON 1|1-101:0| BL:SWS:NREP 1 BL:SWS:REP 2->91|Y1783_SYNY3|4e-04|22.2|90/100| BL:PDB:NREP 1 BL:PDB:REP 5->101|2pd1C|4e-21|45.8|96/99| RP:PDB:NREP 1 RP:PDB:REP 6->97|3e8oA|3e-10|14.3|91/99| HM:PFM:NREP 1 HM:PFM:REP 10->42|PF03992|0.00013|30.3|33/78|ABM| RP:SCP:NREP 1 RP:SCP:REP 5->101|2pd1A1|2e-36|52.6|97/100|d.58.4.11| HM:SCP:REP 1->98|1y0hA_|1.3e-10|29.9|97/0|d.58.4.11|1/1|Dimeric alpha+beta barrel| OP:NHOMO 39 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- --1-----------------------------------21------------1-11-----------1-----------------------------------1----1---------------------------------------------------------------------------1------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------1------1------------------------------------------1-1-------1----------------------------------------------------------------------------1111--------1-1------------------11--2-1---------1-1--------------------------------1--------------------------------------------------------------1-----------------------------------------------------------------------------------------------------1111------------------------1------------------1------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 100.0 SQ:SECSTR EccccEEEEEEEEccTTTHHHHHHHHHHHHHHHTTcTTEEEEEEEEccTTEEEEEEEEccHHHHHHHHTcHHHHHHHHHHHHTTccccEEEEEEccccccc DISOP:02AL 101-102| PSIPRED cccEEEEEEEEEEcccccHHHHHHHHHHcHHHHHcccccEEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHHHccHHHHccccccHHHHHHHccc //