[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68153.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:HMM:PFM   23->40 PF10708 * DUF2510 0.00047 33.3 18/36  
:HMM:PFM   7->25 PF09094 * DUF1925 0.00081 31.6 19/80  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68153.1 GT:GENE BAC68153.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 596972..597148 GB:FROM 596972 GB:TO 597148 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68153.1 LENGTH 58 SQ:AASEQ MFNDRLHLVHRGQANDSLWESVYDGSSWTTDTPIPGRHSWRGPALATYRGALHCLATG GT:EXON 1|1-58:0| HM:PFM:NREP 2 HM:PFM:REP 23->40|PF10708|0.00047|33.3|18/36|DUF2510| HM:PFM:REP 7->25|PF09094|0.00081|31.6|19/80|DUF1925| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccEEEEEEcccccccHHHEEccccccccccccccccccccHHHHHHHHHHHHHccc //