[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68159.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->70 3bguB PDBj 1e-05 31.9 %
:RPS:PDB   1->88 3bguB PDBj 5e-16 26.1 %
:HMM:SCOP  1->104 1rjjA_ d.58.4.4 * 4.6e-17 39.6 %
:RPS:PFM   2->90 PF07876 * Dabb 6e-04 32.6 %
:HMM:PFM   2->92 PF07876 * Dabb 9.6e-17 33.0 91/97  
:HMM:PFM   78->119 PF09278 * MerR-DNA-bind 0.00019 31.0 42/65  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68159.1 GT:GENE BAC68159.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 603569..603973 GB:FROM 603569 GB:TO 603973 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF07876: Stress responsive A/B Barrel Domain GB:PROTEIN_ID BAC68159.1 LENGTH 134 SQ:AASEQ MIYHINRVTMKATATPEQIEGVLESWRNQGRSNPAIKSFVVGRNHGGDYTYGAVFVVEHLDGLFAYLTHPTTYQTDHLGLHLVERLEIFDVSDDDDPDLNAKIQELHRRRNELNPQIAGMLADVPTYTGSGVDD GT:EXON 1|1-134:0| BL:PDB:NREP 1 BL:PDB:REP 2->70|3bguB|1e-05|31.9|69/102| RP:PDB:NREP 1 RP:PDB:REP 1->88|3bguB|5e-16|26.1|88/102| RP:PFM:NREP 1 RP:PFM:REP 2->90|PF07876|6e-04|32.6|89/97|Dabb| HM:PFM:NREP 2 HM:PFM:REP 2->92|PF07876|9.6e-17|33.0|91/97|Dabb| HM:PFM:REP 78->119|PF09278|0.00019|31.0|42/65|MerR-DNA-bind| HM:SCP:REP 1->104|1rjjA_|4.6e-17|39.6|101/0|d.58.4.4|1/1|Dimeric alpha+beta barrel| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----1---------------------1--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 69.4 SQ:SECSTR EEEEEEEEEEcTTccHHHHHHHHHHHHTHHHHcTTccEEEEEEccTTcccEEEEEEEEHHHHHHHHHHcHHHHHHHHHHGGEEEEEEEEEEEE######################################### DISOP:02AL 129-134| PSIPRED cEEEEEEEEEcccccHHHHHHHHHHHHHccHHHHHHHHHHccccccccccEEEEEEEccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccc //