[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68161.1
DDBJ      :             putative anti-sigma factor antagonist
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.13.2
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->98 1thnB PDBj 3e-07 28.4 %
:RPS:PDB   4->103 1auzA PDBj 2e-11 25.3 %
:RPS:SCOP  5->103 1vc1A  c.13.2.1 * 2e-11 26.5 %
:HMM:SCOP  5->115 1h4xA_ c.13.2.1 * 3.8e-24 40.0 %
:RPS:PFM   18->97 PF01740 * STAS 6e-05 32.5 %
:HMM:PFM   11->107 PF01740 * STAS 3.3e-14 24.0 96/117  
:BLT:SWISS 7->98 RSBV_BACLI 5e-09 33.3 %
:PROS 62->73|PS00213|LIPOCALIN
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68161.1 GT:GENE BAC68161.1 GT:PRODUCT putative anti-sigma factor antagonist GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(605005..605373) GB:FROM 605005 GB:TO 605373 GB:DIRECTION - GB:PRODUCT putative anti-sigma factor antagonist GB:NOTE PF01740: STAS domain, phosphorylated/unphosphorylated form GB:PROTEIN_ID BAC68161.1 LENGTH 122 SQ:AASEQ MTDAFHIDVPHTDAALAVIALSGEFDIAAAPAVRARALELIANGHPDLVADLSGVTFCDSSGLGALVGIWRCAKDADGSLTLAAIPDRLSRLLSVTGMDAFLPAYSSADAALAARQGNRTTA GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 7->98|RSBV_BACLI|5e-09|33.3|90/108| PROS 62->73|PS00213|LIPOCALIN|PDOC00187| SEG 28->37|aaapavrara| SEG 104->114|ayssadaalaa| BL:PDB:NREP 1 BL:PDB:REP 18->98|1thnB|3e-07|28.4|81/114| RP:PDB:NREP 1 RP:PDB:REP 4->103|1auzA|2e-11|25.3|99/116| RP:PFM:NREP 1 RP:PFM:REP 18->97|PF01740|6e-05|32.5|80/107|STAS| HM:PFM:NREP 1 HM:PFM:REP 11->107|PF01740|3.3e-14|24.0|96/117|STAS| RP:SCP:NREP 1 RP:SCP:REP 5->103|1vc1A|2e-11|26.5|98/110|c.13.2.1| HM:SCP:REP 5->115|1h4xA_|3.8e-24|40.0|110/111|c.13.2.1|1/1|Anti-sigma factor antagonist SpoIIaa| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------1-----------------------------------------------------1-----2-----------------------------------------------------------------------1-------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 82.0 SQ:SECSTR ###cccccEEEETTEEEEEcccccccTTHHHHHHHHHHHHHccccccEEEEccccccccTTHHHHHHHHHHHHHHHTccccEEcccTTTTHHHHHHccGGGTc################### DISOP:02AL 1-2, 117-122| PSIPRED cccccccccEEEcccEEEEEEcccEEcccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHccccEEEccccHHHHHHccccccccc //